PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G118300.3
Common NameB456_013G118300, LOC105783759
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 174aa    MW: 19693.1 Da    PI: 6.5121
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G118300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-143377147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg++ +eE  l+++++ +lG++ W++Ia +++ gRt++++k++w+ +
  Gorai.013G118300.3 33 RGSFAAEEVNLIINLHSLLGNR-WSLIAGRLP-GRTANDVKNYWNCH 77
                        78999*****************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.13E-201089IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-91439IPR009057Homeodomain-like
PROSITE profilePS500903.9381427IPR017877Myb-like domain
PROSITE profilePS5129424.0722882IPR017930Myb domain
SMARTSM007178.7E-143280IPR001005SANT/Myb domain
PfamPF002497.1E-133375IPR001005SANT/Myb domain
CDDcd001671.13E-93878No hitNo description
Gene3DG3DSA:1.10.10.604.9E-194078IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEKGSGIEYL FWLRCRKSCR LRWLNYLRPN IKRGSFAAEE VNLIINLHSL LGNRWSLIAG  60
RLPGRTANDV KNYWNCHLSK KLNSAPQSED DQTAAATTTA SMKPRRPAHV SPNTQQETSV  120
WAPFHDVQVN QQGQEVAAEE PVTLVGDLEF DEGGSSKWWD DFIFDMDLWT ASL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-17148440110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464852.11e-129PREDICTED: transcription factor MYB113-like isoform X2
TrEMBLA0A0D2TZP21e-128A0A0D2TZP2_G
STRINGGLYMA18G41520.11e-45(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-36myb domain protein 113
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]